They want $1,000

Post your questions about tracing the source IP address of an email here.
New Member
Posts: 1
Joined: Sat Feb 09, 2019 9:19 am

They want $1,000

Post by donrei » Sat Feb 09, 2019 9:32 am

I have received two of these messages below the first asking for $1,000 and the second 4 days later asking for $500 (I didn't react to the first so they have lowered their demand hoping to get some action I guess.) I was on a porn site but I have had my computer's camera scotched taped for over two years and also have McAfee virus malware monitoring computer for two years which when scanned showed no malware or other activity in the last 6 months. So my risk seemed low so I did not react to the first email and nothing happened until I got the second email with the reduced bribe amount.

Here is the email. They are both the same except the $ amount is changed.

Hi, your account was infected! It will be good idea to change the password this time!
You probably do not know anything about me and you may be most probably wanting to know for what reason you are getting this particular message, is it right?
I'mhacker who crackedyour emailand systema few months ago.
Don't attempt to get in touch with me or find me, it is definitely hopeless, because I directed you a letter from YOUR hacked account.
I've build in malware soft to the adult videos (porn) site and guess that you have spent time on this website to have some fun (think you understand what I really mean).
While you have been keeping an eye on these "great" vids, your browser started out to act as a RDP (Remote Control) having a keylogger that gave me permission to access your screen and web camera.
Then, my applicationstoleall data.
You wrote passcodes on the web services you visited, I sniffed them.
Of course, you can modify them, or already modified them.
Even so it doesn't matter, my program updates information regularly.
And what did I do?
I compiled a reserve copy of your system. Of all files and contacts.
I created a dual-screen movie. The 1st part presents the film you had been observing (you've the perfect preferences, wow...), the 2nd part displays the recording from your webcam.
What actually should you do?
Great, in my view, 500 USD is basically a good price for our little riddle. You will make the payment by bitcoins (if you don't recognize this, search “how to purchase bitcoin” in any search engine).
My bitcoin wallet address:
(It is cAsE sensitive, so just copy and paste it).
You have only 2 days to make the payment. (I put an unique pixel to this message, and from now I know that you've read this email).
To monitorthe reading of a messageand the actionsinside it, I utilizea Facebook pixel. Thanks to them. (That whichis appliedfor the authorities may helpus.)

In case I do not get bitcoins, I shall undoubtedly send your recording to all your contacts, along with family members, colleagues, ?and many more?.


X-Clx-Ushades: ⁨Junk⁩
X-Csa-Complaints: ⁨
X-Dmarc-Policy: ⁨none⁩
X-Clx-Spam: ⁨false⁩
User-Agent: ⁨Microsoft-MacOutlook/10.e.1.180613⁩
Authentication-Results: ⁨; dmarc=none⁩
Authentication-Results: ⁨; dkim=none⁩
Authentication-Results: ⁨; spf=fail ( domain of does not designate as permitted sender)
Abuse-Reports-To: ⁨<>⁩
Return-Path: ⁨<>⁩
List-Help: ⁨<>⁩
X-Vr-Status: ⁨SPAM⁩
Original-Recipient: ⁨rfc822;
Organization: ⁨Woeekejmsa⁩
Errors-To: ⁨
X-Proofpoint-Spam-Details: ⁨rule=notspam policy=default score=0 spamscore=0 clxscore=1005 suspectscore=0 malwarescore=0 phishscore=0 adultscore=0 bulkscore=0 classifier=clx:Deliver adjust=0 reason=mlx scancount=1 engine=8.0.1-1812120000 definitions=main-1902050109⁩
X-Aid: ⁨3888684988⁩
X-Proofpoint-Virus-Version: ⁨vendor=fsecure engine=2.50.10434:,, definitions=2019-02-05_06:,, signatures=0⁩
X-Dmarc-Info: ⁨pass=none; dmarc-policy=(nopolicy); s=u0; d=u0⁩
X-Mailer: ⁨WhatCounts⁩
X-Vr-Spamcause: ⁨gggruggvucftvghtrhhoucdtuddrgedtledrkeeigdehhecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucggtfgfnhhsuhgsshgtrhhisggvpdfftffgtefojffquffvnecuuegrihhlohhuthemuceftddtnecuogfuphgrmhfjughrucdlfedttddmnecujfgurhepfggvkfhofffouffhvffgtgefsehtsgfstderreenucfhrhhomhepoehmughonhgrlhgurhesrhgvihhghhhlvgihrdhnvghtqeenucfkphepkedvrddufeehrddugeelrdeltddpvddttddrhedvrddugeekrdduvddvnecurfgrrhgrmhepmhhouggvpehsmhhtphdphhgvlhhopehmgidurdgukhgunhgvthdrtghomhdpihhnvghtpeekvddrudefhedrudegledrledtpdhrvghtuhhrnhdqphgrthhhpeeomhguohhnrghlughrsehrvghighhhlhgvhidrnhgvtheqpdhmrghilhhfrhhomhepohhlihhushhhkhgrsegukhgurdhlthdpnhhrtghpthhtohepmhguohhnrghlughrsehrvghighhhlhgvhidrnhgvthenucevlhhushhtvghrufhiiigvpedt⁩
Content-Transfer-Encoding: ⁨base64⁩
X-Clx-Shades: ⁨Deliver⁩
Content-Type: ⁨text/plain; charset=UTF-8⁩
Received: ⁨from ([]) by (Oracle Communications Messaging Server 64bit (built Sep 6 2017)) with ESMTP id <> for; Tue, 05 Feb 2019 13:56:10 +0000 (GMT)⁩
Received: ⁨from ( []) by (Postfix) with ESMTPS id F2847680071 for <>; Tue, 5 Feb 2019 13:56:09 +0000 (UTC)⁩
Received: ⁨from ( []) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by (Postfix) with ESMTPS id D2DB994146 for <>; Tue, 5 Feb 2019 05:56:06 -0800 (PST)⁩
Received: ⁨from ( []) by (Postfix) with ESMTP id 9A34B42485F5B for <>; Tue, 5 Feb 2019 05:56:03 -0800 (PST)⁩
Received: ⁨from [] (unknown []) (using TLSv1 with cipher DHE-RSA-AES256-SHA (256/256 bits)) (No client certificate requested) by (Postfix) with ESMTP id 692363CF0 for <>; Tue, 5 Feb 2019 15:55:55 +0200 (EET)⁩
X-Vr-Score: ⁨300⁩
Received-Spf: ⁨fail ( domain of does not designate as permitted sender); client-ip=;;
Feedback-Id: ⁨8:bex_ojkuve_vjlweg:qavgcdn⁩
X-Clx-Score: ⁨1005⁩
X-Clx-Unspecialscore: ⁨-349⁩


Dkim-Signature: ⁨v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed;; s=default; h=List-Subscribe:From:Date:Message-ID:To:Subject: Content-Type:Content-Transfer-Encoding:Sender:Reply-To:Cc:MIME-Version: Content-ID:Content-Description:Resent-Date:Resent-From:Resent-Sender: Resent-To:Resent-Cc:Resent-Message-ID:In-Reply-To:References:List-Id: List-Help:List-Unsubscribe:List-Post:List-Owner:List-Archive; bh=NdPEX4bWX9DuFgV2g9/anMfooQ/FOLM96UL7ZZbAkRE=; b=G2e2Xv3w6M2IRmI4dPT6/q8Nv5 EwPal8YBfhosu32YBsV37k9ermtCtQAKZ79eNL+TMB26ORbchrZoDDjqrrYwRydcI8kYGDUEVOpYi +smzBW6nOubnKmfyGoVK5TfbV7IZ3w/a+r9ybZleyWwKzIIWjaEmTu/FKoTcBF/QRjgY=;⁩
X-Csa-Complaints: ⁨
X-Clx-Ushades: ⁨None⁩
X-Dmarc-Policy: ⁨none⁩
X-Sender-Info: ⁨<>⁩
X-Authenticated-Sender: ⁨
X-Clx-Spam: ⁨false⁩
Authentication-Results: ⁨; dmarc=none⁩
Authentication-Results: ⁨; dkim=pass (1024-bit key) header.b=G2e2Xv3w⁩
Authentication-Results: ⁨; spf=softfail ( domain of transitioning does not designate as permitted sender)
Authentication-Results: ⁨; dkim=pass reason="1024-bit key; unprotected key" header.b=G2e2Xv3w; dkim-adsp=none (unprotected policy); dkim-atps=neutral⁩
X-Complaints-To: ⁨
Abuse-Reports-To: ⁨<>⁩
Return-Path: ⁨<>⁩
X-Vr-Status: ⁨SPAM⁩
X-Priority: ⁨1⁩
X-Antiabuse: ⁨This header was added to track abuse, please include it with any abuse report⁩
X-Antiabuse: ⁨Primary Hostname -⁩
X-Antiabuse: ⁨Original Domain -⁩
X-Antiabuse: ⁨Originator/Caller UID/GID - [47 12] / [47 12]⁩
X-Antiabuse: ⁨Sender Address Domain -⁩
Original-Recipient: ⁨rfc822;
X-Dmarc-Info: ⁨pass=none; dmarc-policy=(nopolicy); s=u0; d=u0⁩
X-Proofpoint-Spam-Details: ⁨rule=notspam policy=default score=0 spamscore=0 clxscore=1005 suspectscore=0 malwarescore=0 phishscore=0 adultscore=0 bulkscore=0 classifier=clx:Deliver adjust=0 reason=mlx scancount=1 engine=8.0.1-1812120000 definitions=main-1902090081⁩
X-Proofpoint-Virus-Version: ⁨vendor=fsecure engine=2.50.10434:,, definitions=2019-02-09_10:,, signatures=0⁩
X-Clx-Shades: ⁨Deliver⁩
X-Vr-Spamcause: ⁨gggruggvucftvghtrhhoucdtuddrgedtledrleeggddvfecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucggtfgfnhhsuhgsshgtrhhisggvpdfftffgtefojffquffvnecuuegrihhlohhuthemuceftddtnecunddouefvvedqvfhhrhgvrghtshdqufgvgihtohhrshhiohhnucdlfedttddmnecujfgurhepgfgtuffvkfffhffrtdesthgsjedttddtjeenucfhrhhomhepoehmughonhgrlhgurhesrhgvihhghhhlvgihrdhnvghtqeenucfkphepudelkedrfeekrdekgedrudeikedpudejtddrjeelrddujeekrddufeefnecurfgrrhgrmhepmhhouggvpehsmhhtphdphhgvlhhopegtlhhouhgurdhkhihsihhsqdhsvghrvhgvrhdrnhgvthdpihhnvghtpeduleekrdefkedrkeegrdduieekpdhrvghtuhhrnhdqphgrthhhpeeomhguohhnrghlughrsehrvghighhhlhgvhidrnhgvtheqpdhmrghilhhfrhhomhepjhhsnhgvlheskhihshhishdrvgguuhdrmhihpdhnrhgtphhtthhopehmughonhgrlhgurhesrhgvihhghhhlvgihrdhnvghtnecuvehluhhsthgvrhfuihiivgeptd⁩
Content-Transfer-Encoding: ⁨base64⁩
Received: ⁨from ([]) by (Oracle Communications Messaging Server 64bit (built Sep 6 2017)) with ESMTP id <> for; Sat, 09 Feb 2019 10:55:18 +0000 (GMT)⁩
Received: ⁨from ( []) by (Postfix) with ESMTPS id D252978005E for <>; Sat, 9 Feb 2019 10:55:16 +0000 (UTC)⁩
Received: ⁨from ( []) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by (Postfix) with ESMTPS id 286837F166 for <>; Sat, 9 Feb 2019 02:55:13 -0800 (PST)⁩
Received: ⁨from (unknown []) by (Postfix) with ESMTPS id 9586640005856 for <>; Sat, 9 Feb 2019 02:55:10 -0800 (PST)⁩
Received: ⁨from [] (port=57654 helo=[]) by with esmtpsa (TLSv1:ECDHE-RSA-AES256-SHA:256) (Exim 4.91) (envelope-from <>) id 1gr4dQ-0009tU-M5 for; Wed, 06 Feb 2019 01:35:49 +0800⁩
Content-Type: ⁨text/plain; charset=UTF-8⁩
X-Vr-Score: ⁨300⁩
Feedback-Id: ⁨1n2lbn59wzdl27g8ug3e7p19rtwluaxusfcxzhg5nh1moaw:none:ovtxfpt⁩
X-Get-Message-Sender-Via: ⁨ authenticated_id:
List-Subscribe: ⁨
X-Clx-Score: ⁨1005⁩
Received-Spf: ⁨softfail ( domain of transitioning does not designate as permitted sender); client-ip=;;
X-Clx-Unspecialscore: ⁨23⁩


Thanks in advance to any that may comment.

User avatar
Forum Administrator
Posts: 2463
Joined: Tue Mar 02, 2010 5:41 pm
Location: | ::1

Re: They want $1,000

Post by Chrispcritters » Sat Feb 09, 2019 3:43 pm

This is a sextortion scam.
Founder & CEO of
You can follow me on Twitter and Facebook for some behind the scenes info.


Who is online

Users browsing this forum: No registered users and 2 guests